PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.14G034800.1.p
Common NameGLYMA_14G034800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SRS
Protein Properties Length: 350aa    MW: 36900.8 Da    PI: 8.3423
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.14G034800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702219.66.8e-681332933154
               DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkls 92 
                          sg+++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrerq +++a+++ a +s +++ +k++r   +++++++s+t++s
  Glyma.14G034800.1.p 133 SGGTTCQDCGNQAKKDCTNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERQLMTSATAAVAGSSGSTSGTKKPRLI-ASQTTTTSHTSTS 221
                          7889**********************************************99999999999999999999999986.88899999***** PP

               DUF702  93 saeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          +++++++++tss          lP +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqG+e+
  Glyma.14G034800.1.p 222 NTTPPRSFDTSSshqdagfkesLPGQVRAPAVFKCVRVTAVEDGQDEYAYQAVVKIGGHVFKGFLYDQGVEN 293
                          **********999********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.7E-62135292IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.1E-27137179IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.8E-29244291IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MWSTQARSIN YPEMGMFVVA PASSFHHHHH HQPPQHDPSV MADSLNPATA LGVGVGVIPL  60
LAATPCLESD NNILGSRTRG GGGIQLWQDQ QQHHQSHYMK KQLQQGLLDH NSNTSSGNLI  120
QNSGEVTASG TSSGGTTCQD CGNQAKKDCT NRRCRTCCKS RGFDCPTHVK STWVPAARRR  180
ERQLMTSATA AVAGSSGSTS GTKKPRLIAS QTTTTSHTST SNTTPPRSFD TSSSHQDAGF  240
KESLPGQVRA PAVFKCVRVT AVEDGQDEYA YQAVVKIGGH VFKGFLYDQG VENRDVYPNL  300
SELHLGGGSG GAGRNGVSSS SPMMDPNDVY AASGGGLLGG SSAYGNPMN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.55990.0pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596598.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK94e-89LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLI1M7440.0I1M744_SOYBN; Uncharacterized protein
STRINGGLYMA14G03900.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.28e-71Lateral root primordium (LRP) protein-related